PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0451s0270.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 335aa    MW: 35482.7 Da    PI: 9.0634
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0451s0270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.18.3e-3870129362
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt GGalr vPvGgg+r+nk+s+
  SapurV1A.0451s0270.1.p  70 ETALKCPRCQSTNTKFCYFNNYSLSQPRHFCKTCRRYWTSGGALRSVPVGGGCRRNKRSK 129
                             6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2953118IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3272127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.15273127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVFSSIPAYL GNWQQQPGNQ PPGAGNENPQ LPPQPAPPPG GGYGDIGSTG SIRPGSMTDR  60
ARLAKIHLPE TALKCPRCQS TNTKFCYFNN YSLSQPRHFC KTCRRYWTSG GALRSVPVGG  120
GCRRNKRSKG SGRSKAVPSS SGGPASNCCT ADILGHMPPP PPQPPIFPPL HHLGDYNPAD  180
IGLNFGGIHH SIGVAAGGGD GVEFQIGSGT SPNGVAGSIL SSGLVEQWRL QQVQQQMQQF  240
PFLSNLEPPS AMYSFEGGGI ESSNYGGQIR SKPVETTGAT HPATVKMEEN QRLNLSKKVL  300
GISGIDQHWG GNNAWTDLPA GSVKSNQYED KREP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011028557.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
TrEMBLB9HMH11e-173B9HMH1_POPTR; Uncharacterized protein
STRINGPOPTR_0008s05520.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.22e-42OBF-binding protein 3